PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr8g100050.1
Common NameMTR_8g100050
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family ARF
Protein Properties Length: 834aa    MW: 93075.2 Da    PI: 6.4859
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr8g100050.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B375.84.9e-24162263199
                      EEEE-..-HHHHTT-EE--HHH.HTT......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSS CS
               B3   1 ffkvltpsdvlksgrlvlpkkfaeeh......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrs 88 
                      f+k+lt sd++++g +++ +++a+e+      + k++ +++l+ +d++g++W++++i+r++++r++l++GW+ Fv++++L +gD ++F   + +
  Medtr8g100050.1 162 FCKTLTASDTSTHGGFSVLRRHADEClppldmS-KQPPTQELVAKDLHGNEWRFRHIFRGQPRRHLLQSGWSVFVSSKRLVAGDAFIFL--RGE 252
                      99*****************************63.4445569************************************************..449 PP

                      EE..EEEEE-S CS
               B3  89 efelvvkvfrk 99 
                      ++el+v+v+r+
  Medtr8g100050.1 253 NGELRVGVRRA 263
                      999*****996 PP

2Auxin_resp117.61e-38288370183
       Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                      a+ha+ t+++F+v+Y+Pr+s++eF+v++++++++lk+++++GmRfkm+fe+e+++e+r++Gt+vg++d+d+ rWp SkWr+Lk
  Medtr8g100050.1 288 AWHAVLTGTMFTVYYKPRTSPAEFIVPYDQYMESLKNNYTIGMRFKMRFEGEEAPEQRFTGTIVGIEDSDSKRWPTSKWRCLK 370
                      79*******************************************************************************96 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.31E-40158291IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.109.8E-42158277IPR015300DNA-binding pseudobarrel domain
CDDcd100177.43E-22160262No hitNo description
PfamPF023625.5E-22162263IPR003340B3 DNA binding domain
SMARTSM010191.8E-23162264IPR003340B3 DNA binding domain
PROSITE profilePS5086312.026162264IPR003340B3 DNA binding domain
PfamPF065072.5E-36288370IPR010525Auxin response factor
PfamPF023096.3E-10623798IPR033389AUX/IAA domain
PROSITE profilePS5174522.791710792IPR000270PB1 domain
SuperFamilySSF542777.36E-10713787No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008285Biological Processnegative regulation of cell proliferation
GO:0009734Biological Processauxin-activated signaling pathway
GO:0009737Biological Processresponse to abscisic acid
GO:0009911Biological Processpositive regulation of flower development
GO:0010047Biological Processfruit dehiscence
GO:0010150Biological Processleaf senescence
GO:0010227Biological Processfloral organ abscission
GO:0045892Biological Processnegative regulation of transcription, DNA-templated
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0005515Molecular Functionprotein binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 834 aa     Download sequence    Send to blast
MFGMRDLEEE RNMASSEVSM KGNSVNGKGE NNVDGVGDAQ NGSSSSSTGR EAEAALYREL  60
WHACAGPLVT VPREGELVFY FPQGHIEQVE ASTNQASEQH MPVYDLRPKI LCRVINVMLK  120
AEPDTDEVFA QVTLVPEPNQ DENAVEKEAP PAPPPRFHVH SFCKTLTASD TSTHGGFSVL  180
RRHADECLPP LDMSKQPPTQ ELVAKDLHGN EWRFRHIFRG QPRRHLLQSG WSVFVSSKRL  240
VAGDAFIFLR GENGELRVGV RRAMRQQGNV PSSVISSHSM HLGVLATAWH AVLTGTMFTV  300
YYKPRTSPAE FIVPYDQYME SLKNNYTIGM RFKMRFEGEE APEQRFTGTI VGIEDSDSKR  360
WPTSKWRCLK VRWDETSNIP RPERVSPWKI EPALAPPALN PLPMPRPKRP RANVVPSSPD  420
SSVLTREASS KVSMDPLPTS GFQRVLQGQE SSTLRGNLAE SNDSYTAEKS VAWTPATDEE  480
KMDAVSTSRR YGSENWMPMS RQEPTYSDLL SGFGSTREGK HNMLTQWPVM PPGLSLNFLH  540
SNMKGSAQGS DNATYQAQGN MRYSAFGDYS VLHGHKVENP HGNFLMPPPP PTQYESPHSR  600
ELSQKQMSAK ISEAAKPKDS DCKLFGFSLL SSPTMLEPSL SQRNATSETS SHMQISSQHH  660
TFENDQKSEH SKSSKPADKL VIVDEHEKQL QTSQPHVKDV QLKPQSGSAR SCTKVHKKGI  720
ALGRSVDLTK FSDYDELTAE LDQLFEFRGE LISPQKDWLV VFTDNEGDMM LVGDDPWQEF  780
CSMVRKIYIY PKEEIQKMSP GTLSSKNEEN HSATDGGDAQ ETKSQLNQSA SDN*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldv_A1e-178393922354Auxin response factor 1
4ldw_A1e-178393922354Auxin response factor 1
4ldw_B1e-178393922354Auxin response factor 1
4ldx_A1e-178393922354Auxin response factor 1
4ldx_B1e-178393922354Auxin response factor 1
Search in ModeBase
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Mtr.132100.0flower| glandular trichome| leaf| pod| root| stem
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00574DAPTransfer from AT5G62000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC1267940.0AC126794.15 Medicago truncatula chromosome 4 clone mth2-24j7, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003630583.20.0auxin response factor 2
SwissprotQ94JM30.0ARFB_ARATH; Auxin response factor 2
TrEMBLG7LIT10.0G7LIT1_MEDTR; Auxin response factor
STRINGGLYMA05G38540.40.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF32813366
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G62000.30.0auxin response factor 2
Publications ? help Back to Top
  1. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]